PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_015359-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family HB-other
Protein Properties Length: 971aa    MW: 107086 Da    PI: 8.5278
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_015359-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.39.6e-0761117157
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                    +r+R  ++++ ++ +++lF  + ++s++e +e+++ +g+t  qV+ +F  +R + +k
  NNU_015359-RA  61 KRPRDLLNPKAVKYMQSLFSIKDTISKKESREISALCGVTVMQVREFFAGQRSRVRK 117
                    799**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.31358118IPR001356Homeobox domain
SMARTSM003893.8E-460122IPR001356Homeobox domain
SuperFamilySSF466892.27E-660120IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.8E-661123IPR009057Homeodomain-like
CDDcd000865.00E-461117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 971 aa     Download sequence    Send to blast
MEACMENSTN TFQMFVESQK ELFDEQIDQL QKIVVRQCKL TGANPLSQEM AAGALSIKIG  60
KRPRDLLNPK AVKYMQSLFS IKDTISKKES REISALCGVT VMQVREFFAG QRSRVRKLVQ  120
LSKEKVVRSN AGMASHDGCS TNSNHVMPIS PVPLNSVDPK TVEEAPSCSS QDETIPDIDN  180
SDKNFLENIF NLMRKEETFS GQVKLMEWIL QIQNSSVLYW FLTKDGLMIL ATWLSQAALE  240
EQTTVLLVIL KVLCHLPLHK ALPVHMSAIL QTVNRLRIGE ILSDEVQGQI LSLTSGSSEV  300
GRESESYRAL KLLPASADDS NRRHTRIVSL PQTRERRRVL LVEQPGQKTG GRNQQGAKVV  360
TAIQGRPMSA DDIQKAKMRA TFLQSKYGKT GSPSKHSLLQ RTEDPVKSSA SQTSNSQSID  420
KTPIRSKVEE DTKSTVLGSK NSPIMLKTPV DLKPSLELRV PPEESLKRGQ IPWQTPPELR  480
INGLWGIGAG EKSKEVEIQT ERLRREKETF YHNIQDIPIN PKEPWDLEID YDDTLTPEIP  540
IEQLPDDDAA SLPSPCQNNG DKSATTPVGT NNGSAPEPDL ELLAVLLKNP ELVFALTSGQ  600
CGNLTSEETV KLLDMIKASG IGLPGGLNGS SGKAEQKLEI TSLPSPTPPS ERRMSAWRSE  660
GTKSLLQPPV PATKGGGSGF PAVPATVSLL ENPPATTSVR PQLPTTVITS QIPTVITQLS  720
QQLLPALQPS SSQQTLAAGM PENQLTAMNP SPNQRLLSSP LLPMTHIPVT CPPSQNLHAS  780
SPLLRPETSS IGQMHNLNSA TVSIVLNPPN ERQLVSVPQL PPLLPTPTRP QPPLLPEPPI  840
FSPSYPTMPL NASNSGKQGP FSDSTMDRQG SASNSIAHTN QSNYNAFLGQ PPLLSATRWE  900
TKEFTSEPEL EMWSPERSPM RSPEYRSGWN FTEARRDYGR NSRPDWSRHR SSGRLNRDCR  960
HGGRRWHDRR H
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010269460.10.0PREDICTED: homeobox protein LUMINIDEPENDENS-like isoform X3
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A061DY790.0A0A061DY79_THECC; Homeodomain-like superfamily protein, putative
STRINGVIT_07s0104g01580.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-173HB-other family protein